Skip to content
Peptides Codex
ENFR

Use the arrow keys to choose a result, Enter to open it, and Escape to close.

← Home
GLP-2 analog

Teduglutide

Teduglutide is a synthetic 33-amino-acid analog of glucagon-like peptide-2 (GLP-2).

By The Peptides Codex Editorial TeamIndividual review date not recorded

Page data last changed: . Chemistry registry snapshot: . Registry refreshes and identity assessments are separate from scientific content review.

Length
33 aa
Class
GLP-2 analog
Function
Glucagon-like peptide-2 receptor agonist
Context
Approved for short bowel syndrome

A GLP-2 analog that promotes intestinal mucosal growth in short bowel syndrome.

Also known as: Gattex · Revestive

Part of the Metabolic & GLP-1 peptides cluster

Overview

Teduglutide is a synthetic 33-amino-acid analog of glucagon-like peptide-2 (GLP-2). A single alanine-to-glycine substitution extends its half-life from minutes to hours, and it is an approved therapeutic for short bowel syndrome, where it promotes intestinal mucosal growth. This page is educational and not medical advice.

Source & context

Biological / chemical source: Synthetic 33-amino-acid analog of GLP-2

Primary research or clinical context: Approved for short bowel syndrome

One-residue redesign

Native GLP-2 is degraded almost immediately by dipeptidyl peptidase-4. Replacing the second-position alanine with glycine blocks that cleavage, stretching the half-life to roughly two hours. It is a clean illustration of how a single amino-acid swap rescues a peptide from rapid inactivation.

Intestinal trophic action

By activating GLP-2 receptors in the gut, teduglutide increases villus height and mucosal surface area, improving fluid and nutrient absorption. In short bowel syndrome this can reduce dependence on parenteral nutrition, an outcome studied in its registration trials.

Sequence

One-letter sequence commonly cited for Teduglutide (educational; isoforms and modifications may differ):

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Teduglutide33 aa · C164H252N44O55S · ≈ 3,752.1 DaPEPTIDESCODEX.COMN-terminus →→ C-terminusH1G2D−3G4S5F6S7D−8E−9M10N11T12I13L14D−15N16L17A18A19R+20D−21F22I23N24W25L26I27Q28T29K+30I31T32D−33nonpolarpolaracidicbasicGly / Pronon-canonical (X)Hydropathy (Kyte–Doolittle): ▮ hydrophobic (cyan) / ▮ hydrophilic (rose) · Side-chain charge at pH 7: + / −
Teduglutide — Structure cardDownload SVG
H1G2D3G4S5F6S7D8E9M10N11T12I13L14D15N16L17A18A19R20D21F22I23N24W25L26I27Q28T29K30I31T32D33
Helical wheel projection

Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.

Analyze sequences in the playground →

Structure & chemistry

Molecular identity & reference confidence

Source-supported reference

Reference values are taken from the cited molecular record or curated profile. A database match is not independent laboratory verification; modifications, counter-ions, and formulations can change the measured mass.

Molecular form
Teduglutide (source record; form not independently established)
Species
Not established by this molecular identity audit
Termini (N / C)
Not specified / Not specified

Average reference mass

Reference policy updated: 2026-10-05

Molecular formula
C164H252N44O55S
Average reference mass
≈ 3,752.1
Status
Approved medicine in at least one jurisdiction (IUPHAR record)
Identifiers

Chemistry values: IUPHAR/BPS Guide to Pharmacology, PubChem · fetched 2026-10-01.

Clinical development snapshot

ClinicalTrials.gov lists 50 registered studies with “Teduglutide” as an intervention (snapshot 2026-10-01). A registry footprint is not evidence of efficacy or approval.

Registered studies
50
Highest phase reached
Phase 4
Active in latest 100
6
Most recent update
2026-09-23
Most recently updated studies
NCTTitlePhaseStatusUpdated
NCT01990040Registry for Participants With Short Bowel Syndrome—active not recruiting2026-09-23
NCT06973304A Study of Teduglutide in Chinese Adults With Short Bowel SyndromePhase 3active not recruiting2026-09-08
NCT05023382A Study of Teduglutide in Japanese People With Short Bowel Syndrome—completed2026-08-07
NCT07537686Glucagon-like Peptide 2 (GLP-2) in Undernourished Women Improving From Histology-Confirmed Environmental EnterPhase 2not yet recruiting2026-04-17
NCT07319832A Study of Teduglutide in Chinese Children and Teenagers With Short Bowel Syndrome—recruiting2026-03-13
NCT07400783TED_ORG: Study on Short Bowel SyndromeNot applicablerecruiting2026-02-10
See all on ClinicalTrials.gov →
Concentration math

Teduglutide — reconstitution calculator

Enter how much peptide is in the vial and how much diluent (e.g. bacteriostatic water) is added. The tool returns the resulting solution concentration — and, for any amount you type, the volume it corresponds to. This is educational arithmetic, not a dosing recommendation.

Reference form: Teduglutide (source record; form not independently established)Average reference mass: 3,752.1 Da

Syringe graduation
Solution concentration
5 mg/mL5,000 mcg/mL
mcg

Enter an amount to see the volume it corresponds to.

Educational concentration mathematics only. This tool does not recommend a dose, amount, or protocol, and nothing here is medical advice. Many peptides are not authorized by Health Canada for human use — see our reconstitution and bacteriostatic-water guides for context.

Open the Teduglutide calculator on its own page →

FAQ about Teduglutide

What is Teduglutide?+

Teduglutide is a synthetic 33-amino-acid analog of glucagon-like peptide-2 (GLP-2). A single alanine-to-glycine substitution extends its half-life from minutes to hours, and it is an approved therapeutic for short bowel syndrome, where it promotes intestinal mucosal growth. This page is educational and not medical advice.

What Canadian product status is recorded for Teduglutide?+

Canadian product status for Teduglutide has not been verified in this profile. No verified record here does not mean no authorization exists. Status depends on the product, formulation and use; consult Health Canada's product records.

What is the typical length of Teduglutide?+

Teduglutide is commonly described as approximately 33 amino acids (GLP-2 analog).

Related peptides

Substance P
Neuropeptide
Substance P is an 11-amino-acid neuropeptide of the tachykinin family involved in pain signaling and neurogenic inflammation research.
Defensin (HNP-1)
Antimicrobial
Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.
Vasopressin
Hormone
Vasopressin (antidiuretic hormone) is a nine-residue peptide closely related to oxytocin, central to water balance physiology.
Matrixyl
Cosmetic peptide
Matrixyl is the trade name of palmitoyl pentapeptide-4 (Pal-KTTKS), a lipidated pentapeptide used in anti-wrinkle skincare. The C16 palmitoyl tail lets it self-assemble into nanotapes and stimulates collagen production in human dermal fibroblasts in a concentration-dependent way (Jones et al., Molecular Pharmaceutics 2013). It is a cosmetic ingredient, not a drug, and controlled human data on the peptide itself are scarce.

References & further reading

  1. 1.Chiba et al. (2023). Efficacy and Safety of Teduglutide in Infants and Children With Short Bowel Syndrome Dependent on Parenteral Support. J Pediatr Gastroenterol Nutr
  2. 2.Kim et al. (2017). Teduglutide: A Review in Short Bowel Syndrome. Drugs
  3. 3.Campos Martín et al. (2023). [Review of real-life teduglutide experience]. Nutr Hosp
  4. 4.Burness et al. (2013). Teduglutide: a review of its use in the treatment of patients with short bowel syndrome. Drugs
  5. 5.Naberhuis et al. (2016). Teduglutide for Safe Reduction of Parenteral Nutrient and/or Fluid Requirements in Adults: A Systematic Review. JPEN J Parenter Enteral Nutr
  6. 6.Pérez-Robles et al. (2022). Method for identification and quantification of intact teduglutide peptide using (RP)UHPLC-UV-(HESI/ORBITRAP)MS. Anal Methods
  7. 7.McKeage (2015). Teduglutide: a guide to its use in short bowel syndrome. Clin Drug Investig
  8. 8.Pérez-Robles et al. (2022). Tracking the physicochemical stability of teduglutide (Revestive®) clinical solutions over time in different storage containers. J Pharm Biomed Anal
  9. 9.PubChem — compound summary for Teduglutide (CID 16139605)
  10. 10.Wikipedia — Teduglutide
Disclaimer: Educational content only. Not medical advice. Not instructions for human use. Research peptides and unapproved products may be restricted or illegal to market for human consumption in your jurisdiction. Consult qualified professionals and applicable law.
You might also like: All peptides · Atlas · Research · Tools
Cite this: Peptides Codex — Teduglutide educational profile.
Tip: Use browser print (Ctrl/Cmd + P) for a clean PDF of this page.