Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.
Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.
Source & context
Biological / chemical source: Neutrophils
Primary research or clinical context: Infection research
Antimicrobial peptides
Defensins illustrate how peptide charge, amphipathicity, and disulfide frameworks enable membrane-active host defense — a major AMP research theme.
Sequence
One-letter sequence commonly cited for Defensin (HNP-1) (educational; isoforms and modifications may differ):
ACYCRIPACIAGERRYGTCIYQGRLWAFCC
ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Helical wheel projection
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.
Is Defensin (HNP-1) an approved medicine?+
Defensin (HNP-1) is discussed here as a research / educational topic. Infection research. This is not medical advice.
What is the typical length of Defensin (HNP-1)?+
Defensin (HNP-1) is commonly described as approximately 30 amino acids (Antimicrobial).
Disclaimer: Educational content only. Not medical advice. Not instructions for human use. Research peptides and unapproved products may be restricted or illegal to market for human consumption in your jurisdiction. Consult qualified professionals and applicable law.