Peptides Codex
Home
Antimicrobial

Defensin (HNP-1)

Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.

By The Peptides Codex Editorial TeamReviewed July 10, 2026
Length
30 aa
Class
Antimicrobial
Function
Immune defense
Context
Infection research

Cationic AMP with a characteristic disulfide-stabilized fold.

Part of the Foundational & therapeutic peptides cluster

Overview

Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.

Source & context

Biological / chemical source: Neutrophils

Primary research or clinical context: Infection research

Antimicrobial peptides

Defensins illustrate how peptide charge, amphipathicity, and disulfide frameworks enable membrane-active host defense — a major AMP research theme.

Sequence

One-letter sequence commonly cited for Defensin (HNP-1) (educational; isoforms and modifications may differ):

ACYCRIPACIAGERRYGTCIYQGRLWAFCC

ACYCRIPACIAGERRYGTCIYQGRLWAFCC

A1C2Y3C4R5I6P7A8C9I10A11G12E13R14R15Y16G17T18C19I20Y21Q22G23R24L25W26A27F28C29C30
Helical wheel projection

Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.

Analyze sequences in the playground →

FAQ about Defensin (HNP-1)

What is Defensin (HNP-1)?+

Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.

Is Defensin (HNP-1) an approved medicine?+

Defensin (HNP-1) is discussed here as a research / educational topic. Infection research. This is not medical advice.

What is the typical length of Defensin (HNP-1)?+

Defensin (HNP-1) is commonly described as approximately 30 amino acids (Antimicrobial).

Related peptides

References & further reading

  1. 1.Wikipedia — Alpha defensin
  2. 2.PubChem — compound summary for Human Defensin NP-1 / HNP-1 (CID 16130476)
Disclaimer: Educational content only. Not medical advice. Not instructions for human use. Research peptides and unapproved products may be restricted or illegal to market for human consumption in your jurisdiction. Consult qualified professionals and applicable law.
You might also like: All peptides · Atlas · Research · Tools
Cite this: Peptides Codex — Defensin (HNP-1) educational profile.
Tip: Use browser print (Ctrl/Cmd + P) for a clean PDF of this page.