Page data last changed: . Chemistry registry snapshot: . Registry refreshes and identity assessments are separate from scientific content review.
Cationic AMP with a characteristic disulfide-stabilized fold.
Part of the Foundational & therapeutic peptides cluster
Overview
Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.
Source & context
Biological / chemical source: Neutrophils
Primary research or clinical context: Infection research
Antimicrobial peptides
Defensins illustrate how peptide charge, amphipathicity, and disulfide frameworks enable membrane-active host defense — a major AMP research theme.
Sequence
One-letter sequence commonly cited for Defensin (HNP-1) (educational; isoforms and modifications may differ):
ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
Structure & chemistry
Molecular identity & reference confidence
Source-supported reference
Reference values are taken from the cited molecular record or curated profile. A database match is not independent laboratory verification; modifications, counter-ions, and formulations can change the measured mass.
- Molecular form
- Defensin (HNP-1) (source record; form not independently established)
- Species
- Not established by this molecular identity audit
- Termini (N / C)
- Not specified / Not specified
Average reference mass
Reference policy updated: 2026-10-05
- IUPHAR/BPS source snapshot · 2026-10-01
- PubChem molecular record · 2026-10-01
- Molecular formula
- C167H257N47O46
- Average reference mass
- ≈ 3,659.1
- PubChem CID: 56841867
- IUPHAR ligand: 3648
- CAS RN: 68563-24-6
- UNII: H48TH4J2A2
Chemistry values: PubChem, IUPHAR/BPS Guide to Pharmacology · fetched 2026-10-01.
Clinical development snapshot
ClinicalTrials.gov lists 22 registered studies with “Defensin” as an intervention (snapshot 2026-09-06). A registry footprint is not evidence of efficacy or approval.
| NCT | Title | Phase | Status | Updated |
|---|---|---|---|---|
| NCT06402877 | Evaluation of Salivary Adseverin, 1-Alpha Defensin and sRANKL Levels of Individuals With Different Periodontal | — | completed | 2026-08-12 |
| NCT03704766 | Alpha-Defensin and Synovial Proteins to Improve Detection of Pediatric Septic Arthritis | Not applicable | recruiting | 2026-07-29 |
| NCT04522843 | Analysis of Intestinal Defensin Expression in Acute GVHD | — | completed | 2024-12-18 |
| NCT04849936 | A Diagnostic Accuracy Study Testing Fecal Biomarkers In Comparison To Endoscopic Examination | — | unknown | 2022-05-18 |
| NCT05082766 | Improvement in the Appearance of Periorbital Wrinkles | Phase 3 | unknown | 2021-10-28 |
| NCT04946617 | Chlorhexidine and Essential Oil Mouthwashes on Human Beta-Defensin 2 (hbD2) and Kathelicidin (LL-37) Saliva Le | — | unknown | 2021-07-01 |
Defensin (HNP-1) — reconstitution calculator
Enter how much peptide is in the vial and how much diluent (e.g. bacteriostatic water) is added. The tool returns the resulting solution concentration — and, for any amount you type, the volume it corresponds to. This is educational arithmetic, not a dosing recommendation.
Reference form: Defensin (HNP-1) (source record; form not independently established)Average reference mass: 3,659.1 Da
Enter an amount to see the volume it corresponds to.
Educational concentration mathematics only. This tool does not recommend a dose, amount, or protocol, and nothing here is medical advice. Many peptides are not authorized by Health Canada for human use — see our reconstitution and bacteriostatic-water guides for context.
FAQ about Defensin (HNP-1)
What is Defensin (HNP-1)?+
Human neutrophil peptide-1 (HNP-1) is an alpha-defensin antimicrobial peptide with a disulfide-stabilized structure important in innate immunity research.
What Canadian product status is recorded for Defensin (HNP-1)?+
Canadian product status for Defensin (HNP-1) has not been verified in this profile. No verified record here does not mean no authorization exists. Status depends on the product, formulation and use; consult Health Canada's product records.
What is the typical length of Defensin (HNP-1)?+
Defensin (HNP-1) is commonly described as approximately 30 amino acids (Antimicrobial).
Related peptides
References & further reading
- 1.Ptaszyńska et al. (2018). Antimicrobial Activity of Chimera Peptides Composed of Human Neutrophil Peptide 1 (HNP-1) Truncated Analogues and Bovine Lactoferrampin. Bioconjug Chem
- 2.Moazzezy et al. (2022). Computational evaluation of modified peptides from human neutrophil peptide 1 (HNP-1). J Biomol Struct Dyn
- 3.Dabirian et al. (2013). Human neutrophil peptide-1 (HNP-1): a new anti-leishmanial drug candidate. PLoS Negl Trop Dis
- 4.Lee et al. (2023). Alpha-Defensin 1: An Emerging Periodontitis Biomarker. Diagnostics (Basel)
- 5.Paulin et al. (2017). Human Neutrophil Peptide 1 Limits Hypercholesterolemia-induced Atherosclerosis by Increasing Hepatic LDL Clearance. EBioMedicine
- 6.Fischer et al. (2020). Human peptide α-defensin-1 interferes with Clostridioides difficile toxins TcdA, TcdB, and CDT. FASEB J
- 7.Gandotra et al. (2022). Aptamer selection against alpha-defensin human neutrophil peptide 1 on an integrated microfluidic system for diagnosis of periprosthetic joint infections. Lab Chip
- 8.Kim et al. (2019). Newly Identified HNP-F from Human Neutrophil Peptide-1 Promotes Hemostasis. Biotechnol J
- 9.PubChem — compound summary for Human Defensin NP-1 / HNP-1 (CID 16130476)
- 10.Wikipedia — Alpha defensin