Peptides Codex
Home
Hormone

Insulin

Insulin is a 51-amino-acid peptide hormone that regulates blood glucose. It is the foundational peptide therapeutic and a reference point for modern peptide drug design.

By The Peptides Codex Editorial TeamReviewed July 10, 2026
Length
51 aa
Class
Hormone
Function
Glucose regulation
Context
Diabetes treatment (approved therapeutic)

First peptide therapeutic — transformed diabetes care in the 1920s.

Part of the Foundational & therapeutic peptides cluster

Overview

Insulin is a 51-amino-acid peptide hormone that regulates blood glucose. It is the foundational peptide therapeutic and a reference point for modern peptide drug design.

Source & context

Biological / chemical source: Pancreas (human/recombinant)

Primary research or clinical context: Diabetes treatment (approved therapeutic)

Structure and chains

Mature human insulin consists of an A chain (21 residues) and B chain (30 residues) linked by disulfide bonds. Recombinant production in bacteria or yeast replaced animal-sourced insulin decades ago.

Why it matters in peptide science

Insulin demonstrated that peptides can be manufactured at scale, formulated for injection, and used as lifelong therapies. Many later peptide drugs reuse lessons from insulin formulation and delivery.

Sequence

One-letter sequence commonly cited for Insulin (educational; isoforms and modifications may differ):

GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT

GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT

G1I2V3E4Q5C6C7T8S9I10C11S12L13Y14Q15L16E17N18Y19C20N21F22V23N24Q25H26L27C28G29S30H31L32V33E34A35L36Y37L38V39C40G41E42R43G44F45F46Y47T48P49K50T51
Helical wheel projection

Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.

Analyze sequences in the playground →

FAQ about Insulin

What is Insulin?+

Insulin is a 51-amino-acid peptide hormone that regulates blood glucose. It is the foundational peptide therapeutic and a reference point for modern peptide drug design.

Is Insulin an approved medicine?+

Insulin: Diabetes treatment (approved therapeutic). Always follow licensed medical guidance for approved products.

What is the typical length of Insulin?+

Insulin is commonly described as approximately 51 amino acids (Hormone).

Related peptides

References & further reading

  1. 1.Wikipedia — Insulin
  2. 2.PubChem — compound summary for Insulin Human (CID 118984375)
Disclaimer: Educational content only. Not medical advice. Not instructions for human use. Research peptides and unapproved products may be restricted or illegal to market for human consumption in your jurisdiction. Consult qualified professionals and applicable law.
You might also like: All peptides · Atlas · Research · Tools
Cite this: Peptides Codex — Insulin educational profile.
Tip: Use browser print (Ctrl/Cmd + P) for a clean PDF of this page.