The active N-terminal 34 residues of parathyroid hormone, made recombinantly.
Also known as: Forteo · PTH(1-34)
Part of the Foundational & therapeutic peptides cluster
Overview
Teriparatide is the first 34 amino acids of human parathyroid hormone (PTH), produced by recombinant technology and retaining the receptor-binding activity of the full hormone. It is an approved prescription drug used in bone research and osteoporosis medicine. This page is educational and not medical advice.
Source & context
Biological / chemical source: Recombinant N-terminal 1-34 fragment of human PTH
Primary research or clinical context: Prescription medicine approved in Canada and the US
Structure and origin
Full-length PTH has 84 residues, but its biological activity resides in the N-terminus. Teriparatide reproduces residues 1-34 (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF), enough to activate the PTH1 receptor. It is a classic example of using a defined hormone fragment as a therapeutic peptide.
Approval and status
Sold as Forteo, teriparatide was approved by the FDA in 2002 and is likewise a prescription medicine in Canada. Because it is a scheduled drug, it is used only under medical supervision. This educational summary describes the peptide fragment and its receptor target without offering dosing or treatment recommendations.
Sequence
One-letter sequence commonly cited for Teriparatide (educational; isoforms and modifications may differ):
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
FAQ about Teriparatide
What is Teriparatide?+
Teriparatide is the first 34 amino acids of human parathyroid hormone (PTH), produced by recombinant technology and retaining the receptor-binding activity of the full hormone. It is an approved prescription drug used in bone research and osteoporosis medicine. This page is educational and not medical advice.
Is Teriparatide an approved medicine?+
Teriparatide: Prescription medicine approved in Canada and the US. Always follow licensed medical guidance for approved products.
What is the typical length of Teriparatide?+
Teriparatide is commonly described as approximately 34 amino acids (Recombinant parathyroid hormone fragment).