Page data last changed: . Registry refreshes and identity assessments are separate from scientific content review.
The active N-terminal 34 residues of parathyroid hormone, made recombinantly.
Also known as: Forteo · PTH(1-34)
Part of the Foundational & therapeutic peptides cluster
Overview
Teriparatide is the first 34 amino acids of human parathyroid hormone (PTH), produced by recombinant technology and retaining the receptor-binding activity of the full hormone. It is an approved prescription drug used in bone research and osteoporosis medicine. This page is educational and not medical advice.
Source & context
Biological / chemical source: Recombinant N-terminal 1-34 fragment of human PTH
Primary research or clinical context: Prescription medicine approved in Canada and the US
Structure and origin
Full-length PTH has 84 residues, but its biological activity resides in the N-terminus. Teriparatide reproduces residues 1-34 (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF), enough to activate the PTH1 receptor. It is a classic example of using a defined hormone fragment as a therapeutic peptide.
Approval and status
Sold as Forteo, teriparatide was approved by the FDA in 2002 and is likewise a prescription medicine in Canada. Because it is a scheduled drug, it is used only under medical supervision. This educational summary describes the peptide fragment and its receptor target without offering dosing or treatment recommendations.
Sequence of the selected reference form
Sequence backbone for the reference form: Teriparatide human PTH(1-34) free peptide. Termini, stereochemistry and modifications are described below.
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
Structure & chemistry
Molecular identity & reference confidence
Source-supported reference
The selected reference is the unmodified human PTH(1-34) parent with free termini. Official label chemistry agrees with the 34-residue sequence. The disputed PubChem CIDs have identical full InChIKeys and formulas in the dated response, resolving their literal identifier difference.
- Molecular form
- Teriparatide human PTH(1-34) free peptide
- Species
- Homo sapiens PTH(1-34) amino-acid sequence; recombinant production
- Termini (N / C)
- Free L-seryl amino terminus / Free L-phenylalanine carboxylic acid
Average reference mass · Molecular identity assessment: 2026-10-05
Reference policy updated: 2026-10-05
- PubChem PUG REST selected parent properties · 2026-10-05
- PubChem selected-parent biologic notation · 2026-10-05
- PubChem selected-parent identifiers with depositor attribution · 2026-10-05
- NIH GSRS independently selected parent record · 2026-10-05
- Official product label chemical description, selected parent distinguished from formulation · 2026-10-05
- Molecular formula
- C181H291N55O51S2
- Average reference mass
- ≈ 4,117.8
- Backbone
- Teriparatide human PTH(1-34) free peptide
- C-terminus
- Free L-phenylalanine carboxylic acid
- PubChem CID: 16133850
- CAS RN: 52232-67-4
- UNII: 10T9CSU89I
Chemistry values: curated profile, PubChem.
Clinical development snapshot
ClinicalTrials.gov lists 182 registered studies with “Teriparatide” as an intervention (snapshot 2026-09-06). A registry footprint is not evidence of efficacy or approval.
| NCT | Title | Phase | Status | Updated |
|---|---|---|---|---|
| NCT03994172 | Novel Combination Therapy for Osteoporosis in Men | Phase 4 | completed | 2026-09-03 |
| NCT07242612 | Bone Turnover Markers and Treatment Efficacy in Postmenopausal Osteoporosis | Not applicable | completed | 2026-08-13 |
| NCT06164795 | Sequential Therapies After Osteoanabolic Treatment | — | recruiting | 2026-07-22 |
| NCT07497503 | A Study of B-3E07 and Forsteo® in Healthy Adult Female Participants | Phase 1 | recruiting | 2026-07-16 |
| NCT03735537 | Treatment of Osteogenesis Imperfecta With Parathyroid Hormone and Zoledronic Acid | Phase 4 | completed | 2026-06-11 |
| NCT01293292 | Teriparatide (Forsteo) Treatment in Postmenopausal Women: Mechanism of Action | Phase 4 | completed | 2026-05-19 |
Teriparatide — reconstitution calculator
Enter how much peptide is in the vial and how much diluent (e.g. bacteriostatic water) is added. The tool returns the resulting solution concentration — and, for any amount you type, the volume it corresponds to. This is educational arithmetic, not a dosing recommendation.
Reference form: Teriparatide human PTH(1-34) free peptideAverage reference mass: 4,117.8 Da
Enter an amount to see the volume it corresponds to.
Educational concentration mathematics only. This tool does not recommend a dose, amount, or protocol, and nothing here is medical advice. Many peptides are not authorized by Health Canada for human use — see our reconstitution and bacteriostatic-water guides for context.
FAQ about Teriparatide
What is Teriparatide?+
Teriparatide is the first 34 amino acids of human parathyroid hormone (PTH), produced by recombinant technology and retaining the receptor-binding activity of the full hormone. It is an approved prescription drug used in bone research and osteoporosis medicine. This page is educational and not medical advice.
What Canadian product status is recorded for Teriparatide?+
Canadian product status for Teriparatide has not been verified in this profile. No verified record here does not mean no authorization exists. Status depends on the product, formulation and use; consult Health Canada's product records.
What is the length of the selected reference form for Teriparatide?+
The selected reference form (Teriparatide human PTH(1-34) free peptide) has 34 residues or residue-derived units in its backbone. Other forms in this family may have a different length.
Related peptides
References & further reading
- 1.Leder et al. (2015). Denosumab and teriparatide transitions in postmenopausal osteoporosis (the DATA-Switch study): extension of a randomised controlled trial. Lancet
- 2.Li et al. (2024). Efficacy and safety of teriparatide vs. bisphosphonates and denosumab vs. bisphosphonates in osteoporosis not previously treated with bisphosphonates: a systematic review and meta-analysis of randomized controlled trials. Arch Osteoporos
- 3.Bazaldua et al. (2004). Teriparatide (Forteo) for osteoporosis. Am Fam Physician
- 4.Quattrocchi et al. (2004). Teriparatide: a review. Clin Ther
- 5.Tabatabai et al. (2025). Comparative Effectiveness of Abaloparatide and Teriparatide in Women 50 Years of Age and Older: Update of a Real-World Retrospective Analysis. Endocr Pract
- 6.Drakopoulos et al. (2021). Off-Label Use of Teriparatide in Spine. Cureus
- 7.Blick et al. (2009). Spotlight on teriparatide in osteoporosis. BioDrugs
- 8.Yoshiyama et al. (2025). Persistence of romosozumab vs. teriparatide in Japanese older adults aged ≥ 75 years with osteoporosis: a population-based cohort study. Arch Osteoporos
- 9.PubChem — compound summary for Teriparatide (CID 16133850)
- 10.Wikipedia — Teriparatide