A satiety hormone from the same L-cells that make GLP-1.
Also known as: PYY · peptide tyrosine tyrosine
Part of the Metabolic & GLP-1 peptides cluster
Overview
Peptide YY (PYY) is a 36-amino-acid gut hormone released from intestinal L-cells after eating, where it contributes to satiety and slows gastric emptying. Named for its tyrosine residues at each end, it is a heavily studied signal in appetite and energy-balance research.
Source & context
Biological / chemical source: Intestinal L-cells (ileum and colon)
Primary research or clinical context: Endogenous hormone widely studied in appetite and energy-balance research
PYY(3-36) and the receptor family
The enzyme DPP-4 trims full-length PYY(1-36) into PYY(3-36), shifting its preference among neuropeptide-Y (NPY) family receptors. This active fragment is the form most associated with appetite research — a clear example of how proteolytic processing changes a peptide's receptor selectivity and biology.
Co-secretion with GLP-1
PYY is released from the same L-cells that secrete GLP-1, so the two hormones rise together after meals and are often studied side by side. This page describes that physiology for educational purposes and makes no claims about weight-management outcomes or products.
Sequence
One-letter sequence commonly cited for Peptide YY (educational; isoforms and modifications may differ):
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
FAQ about Peptide YY
What is Peptide YY?+
Peptide YY (PYY) is a 36-amino-acid gut hormone released from intestinal L-cells after eating, where it contributes to satiety and slows gastric emptying. Named for its tyrosine residues at each end, it is a heavily studied signal in appetite and energy-balance research.
Is Peptide YY an approved medicine?+
Peptide YY is discussed here as a research / educational topic. Endogenous hormone widely studied in appetite and energy-balance research. This is not medical advice.
What is the typical length of Peptide YY?+
Peptide YY is commonly described as approximately 36 amino acids (Gut hormone).