Page data last changed: . Chemistry registry snapshot: . Registry refreshes and identity assessments are separate from scientific content review.
A satiety hormone from the same L-cells that make GLP-1.
Also known as: PYY · peptide tyrosine tyrosine
Part of the Metabolic & GLP-1 peptides cluster
Overview
Peptide YY (PYY) is a 36-amino-acid gut hormone released from intestinal L-cells after eating, where it contributes to satiety and slows gastric emptying. Named for its tyrosine residues at each end, it is a heavily studied signal in appetite and energy-balance research.
Source & context
Biological / chemical source: Intestinal L-cells (ileum and colon)
Primary research or clinical context: Endogenous hormone widely studied in appetite and energy-balance research
PYY(3-36) and the receptor family
The enzyme DPP-4 trims full-length PYY(1-36) into PYY(3-36), shifting its preference among neuropeptide-Y (NPY) family receptors. This active fragment is the form most associated with appetite research — a clear example of how proteolytic processing changes a peptide's receptor selectivity and biology.
Co-secretion with GLP-1
PYY is released from the same L-cells that secrete GLP-1, so the two hormones rise together after meals and are often studied side by side. This page describes that physiology for educational purposes and makes no claims about weight-management outcomes or products.
Sequence
One-letter sequence commonly cited for Peptide YY (educational; isoforms and modifications may differ):
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
Structure & chemistry
Molecular identity & reference confidence
Source-supported reference
Reference values are taken from the cited molecular record or curated profile. A database match is not independent laboratory verification; modifications, counter-ions, and formulations can change the measured mass.
- Molecular form
- Peptide YY (source record; form not independently established)
- Species
- Not established by this molecular identity audit
- Termini (N / C)
- Not specified / Not specified
Average reference mass
Reference policy updated: 2026-10-05
- IUPHAR/BPS source snapshot · 2026-10-01
- PubChem molecular record · 2026-10-01
- Molecular formula
- C194H294N54O58
- Average reference mass
- ≈ 4,311
Chemistry values: PubChem, IUPHAR/BPS Guide to Pharmacology · fetched 2026-10-01.
Clinical development snapshot
ClinicalTrials.gov lists 41 registered studies with “Peptide YY” as an intervention (snapshot 2026-10-01). A registry footprint is not evidence of efficacy or approval.
| NCT | Title | Phase | Status | Updated |
|---|---|---|---|---|
| NCT06818032 | Avocado and Postprandial Responses | Not applicable | completed | 2026-07-22 |
| NCT07540949 | Rutazyme Lemon Fermented Product Capsules for Metabolic Function in Adults With Obesity | Not applicable | recruiting | 2026-04-21 |
| NCT05725681 | Satiety of High-Protein Ramen Noodles | Not applicable | completed | 2025-04-23 |
| NCT03338387 | Co-Feedback Action of Growth Hormone, PP and PYY on Ghrelin in Bulimia | Phase 2 | enrolling by invitation | 2025-02-19 |
| NCT05822167 | Effect of Food Temperature and Diet Composition on Satiety, Satiety Hormones, Chewing Time and Neuronal Activi | Not applicable | completed | 2024-07-24 |
| NCT02381249 | The Effect of Satiety Gut Hormone Modulation on Appetitive Drive After Upper Gastrointestinal Surgery | Not applicable | completed | 2023-11-27 |
Peptide YY — reconstitution calculator
Enter how much peptide is in the vial and how much diluent (e.g. bacteriostatic water) is added. The tool returns the resulting solution concentration — and, for any amount you type, the volume it corresponds to. This is educational arithmetic, not a dosing recommendation.
Reference form: Peptide YY (source record; form not independently established)Average reference mass: 4,311 Da
Enter an amount to see the volume it corresponds to.
Educational concentration mathematics only. This tool does not recommend a dose, amount, or protocol, and nothing here is medical advice. Many peptides are not authorized by Health Canada for human use — see our reconstitution and bacteriostatic-water guides for context.
FAQ about Peptide YY
What is Peptide YY?+
Peptide YY (PYY) is a 36-amino-acid gut hormone released from intestinal L-cells after eating, where it contributes to satiety and slows gastric emptying. Named for its tyrosine residues at each end, it is a heavily studied signal in appetite and energy-balance research.
What Canadian product status is recorded for Peptide YY?+
Canadian product status for Peptide YY has not been verified in this profile. No verified record here does not mean no authorization exists. Status depends on the product, formulation and use; consult Health Canada's product records.
What is the typical length of Peptide YY?+
Peptide YY is commonly described as approximately 36 amino acids (Gut hormone).
Related peptides
References & further reading
- 1.Chandarana et al. (2008). Peptide YY. Curr Opin Endocrinol Diabetes Obes
- 2.Pierre et al. (2023). Peptide YY: A Paneth cell antimicrobial peptide that maintains Candida gut commensalism. Science
- 3.Stanley et al. (2004). Gastrointestinal satiety signals III. Glucagon-like peptide 1, oxyntomodulin, peptide YY, and pancreatic polypeptide. Am J Physiol Gastrointest Liver Physiol
- 4.Tough et al. (2024). Enteroendocrine cell-derived peptide YY signalling is stimulated by pinolenic acid or Intralipid and involves coactivation of fatty acid receptors FFA1, FFA4 and GPR119. Neuropeptides
- 5.Reddy et al. (2024). Dapagliflozin, peptide YY, and weight loss in heart failure with preserved ejection fraction. Eur Heart J
- 6.Lafferty et al. (2018). Emerging therapeutic potential for peptide YY for obesity-diabetes. Peptides
- 7.Persaud et al. (2014). Peptide YY: more than just an appetite regulator. Diabetologia
- 8.Tschöp et al. (2007). Peptide YY: obesity's cause and cure?. Am J Physiol Endocrinol Metab
- 9.PubChem — compound summary for Peptide YY (CID 56841989)
- 10.Wikipedia — Peptide YY