Nature's own GLP-1/glucagon dual agonist — the conceptual ancestor of engineered dual peptides.
Also known as: OXM
Part of the Metabolic & GLP-1 peptides cluster
Overview
Oxyntomodulin is a 37-amino-acid gut hormone released from intestinal L-cells after eating. Because it activates both the GLP-1 and glucagon receptors on its own, it is frequently cited as the natural inspiration for engineered dual-agonist metabolic peptides.
Source & context
Biological / chemical source: Intestinal L-cells (proglucagon-derived)
Primary research or clinical context: Endogenous hormone; a natural template for dual-agonist metabolic peptide design
A built-in dual agonist
Oxyntomodulin is derived from the same proglucagon precursor as GLP-1 and contains the full glucagon sequence plus a C-terminal extension. That structure lets a single molecule engage two receptors — the exact property drug designers later tried to reproduce synthetically in tirzepatide-style and triple-agonist peptides.
Research framing
Oxyntomodulin is studied in appetite and energy-balance research and has appeared in early clinical investigations. Coverage here is educational and focuses on its receptor pharmacology and its place in the proglucagon family, not on dosing or human-use protocols.
Sequence
One-letter sequence commonly cited for Oxyntomodulin (educational; isoforms and modifications may differ):
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
FAQ about Oxyntomodulin
What is Oxyntomodulin?+
Oxyntomodulin is a 37-amino-acid gut hormone released from intestinal L-cells after eating. Because it activates both the GLP-1 and glucagon receptors on its own, it is frequently cited as the natural inspiration for engineered dual-agonist metabolic peptides.
Is Oxyntomodulin an approved medicine?+
Oxyntomodulin is discussed here as a research / educational topic. Endogenous hormone; a natural template for dual-agonist metabolic peptide design. This is not medical advice.
What is the typical length of Oxyntomodulin?+
Oxyntomodulin is commonly described as approximately 37 amino acids (Gut hormone).