Peptides Codex
Home
Gut hormone

Oxyntomodulin

Oxyntomodulin is a 37-amino-acid gut hormone released from intestinal L-cells after eating. Because it activates both the GLP-1 and glucagon receptors on its own, it is frequently cited as the natural inspiration for engineered dual-agonist metabolic peptides.

By The Peptides Codex Editorial TeamReviewed July 10, 2026
Length
37 aa
Class
Gut hormone
Function
Naturally dual-acting: activates both GLP-1 and glucagon receptors
Context
Endogenous hormone; a natural template for dual-agonist metabolic peptide design

Nature's own GLP-1/glucagon dual agonist — the conceptual ancestor of engineered dual peptides.

Also known as: OXM

Part of the Metabolic & GLP-1 peptides cluster

Overview

Oxyntomodulin is a 37-amino-acid gut hormone released from intestinal L-cells after eating. Because it activates both the GLP-1 and glucagon receptors on its own, it is frequently cited as the natural inspiration for engineered dual-agonist metabolic peptides.

Source & context

Biological / chemical source: Intestinal L-cells (proglucagon-derived)

Primary research or clinical context: Endogenous hormone; a natural template for dual-agonist metabolic peptide design

A built-in dual agonist

Oxyntomodulin is derived from the same proglucagon precursor as GLP-1 and contains the full glucagon sequence plus a C-terminal extension. That structure lets a single molecule engage two receptors — the exact property drug designers later tried to reproduce synthetically in tirzepatide-style and triple-agonist peptides.

Research framing

Oxyntomodulin is studied in appetite and energy-balance research and has appeared in early clinical investigations. Coverage here is educational and focuses on its receptor pharmacology and its place in the proglucagon family, not on dosing or human-use protocols.

Sequence

One-letter sequence commonly cited for Oxyntomodulin (educational; isoforms and modifications may differ):

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

H1S2Q3G4T5F6T7S8D9Y10S11K12Y13L14D15S16R17R18A19Q20D21F22V23Q24W25L26M27N28T29K30R31N32R33N34N35I36A37
Helical wheel projection

Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.

Analyze sequences in the playground →

FAQ about Oxyntomodulin

What is Oxyntomodulin?+

Oxyntomodulin is a 37-amino-acid gut hormone released from intestinal L-cells after eating. Because it activates both the GLP-1 and glucagon receptors on its own, it is frequently cited as the natural inspiration for engineered dual-agonist metabolic peptides.

Is Oxyntomodulin an approved medicine?+

Oxyntomodulin is discussed here as a research / educational topic. Endogenous hormone; a natural template for dual-agonist metabolic peptide design. This is not medical advice.

What is the typical length of Oxyntomodulin?+

Oxyntomodulin is commonly described as approximately 37 amino acids (Gut hormone).

Related peptides

References & further reading

  1. 1.Wikipedia — Oxyntomodulin
  2. 2.PubChem — compound summary for Oxyntomodulin (CID 16144019)
Disclaimer: Educational content only. Not medical advice. Not instructions for human use. Research peptides and unapproved products may be restricted or illegal to market for human consumption in your jurisdiction. Consult qualified professionals and applicable law.
You might also like: All peptides · Atlas · Research · Tools
Cite this: Peptides Codex — Oxyntomodulin educational profile.
Tip: Use browser print (Ctrl/Cmd + P) for a clean PDF of this page.