Page data last changed: . Chemistry registry snapshot: . Registry refreshes and identity assessments are separate from scientific content review.
Engineered amylin analog: proline substitutions prevent the amyloid aggregation seen with native human amylin.
Also known as: Symlin · AC-137
Part of the Metabolic & GLP-1 peptides cluster
Overview
Pramlintide is a synthetic analog of the pancreatic hormone amylin, designed with proline substitutions so it stays soluble rather than aggregating. It is an approved prescription medicine in the United States used alongside insulin, and is a common case study in peptide formulation and analog design.
Source & context
Biological / chemical source: Synthetic peptide (soluble, non-aggregating amylin analog)
Primary research or clinical context: Approved prescription medicine in the United States (adjunct to insulin); prescription only
Why the substitutions matter
Native human amylin readily forms insoluble amyloid fibrils, which makes it unsuitable as a drug. Pramlintide replaces three residues (positions 25, 28 and 29) with proline, disrupting the beta-sheet stacking that drives aggregation while retaining receptor activity. It is a textbook example of sequence editing to solve a formulation problem.
Regulatory and educational context
Pramlintide is a regulated prescription product, not a research chemical. This page is educational and describes its chemistry and approval history only. It is administered under medical supervision, and any decision about prescription medicines belongs with a licensed clinician — not with online protocol discussions.
Sequence
One-letter sequence commonly cited for Pramlintide (educational; isoforms and modifications may differ):
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
Structure & chemistry
Molecular identity & reference confidence
Source-supported reference
Reference values are taken from the cited molecular record or curated profile. A database match is not independent laboratory verification; modifications, counter-ions, and formulations can change the measured mass.
- Molecular form
- Pramlintide (source record; form not independently established)
- Species
- Not established by this molecular identity audit
- Termini (N / C)
- Not specified / Not specified
Average reference mass
Reference policy updated: 2026-10-05
- IUPHAR/BPS source snapshot · 2026-10-01
- PubChem molecular record · 2026-10-01
- Molecular formula
- C171H267N51O53S2
- Average reference mass
- ≈ 3,949
- Status
- Approved medicine in at least one jurisdiction (IUPHAR record)
- PubChem CID: 70691388
- IUPHAR ligand: 7482
- DrugBank: DB01278
- CAS RN: 151126-32-8
- UNII: D3FM8FA78T
Chemistry values: PubChem, IUPHAR/BPS Guide to Pharmacology · fetched 2026-10-01.
Clinical development snapshot
ClinicalTrials.gov lists 64 registered studies with “Pramlintide” as an intervention (snapshot 2026-10-01). A registry footprint is not evidence of efficacy or approval.
| NCT | Title | Phase | Status | Updated |
|---|---|---|---|---|
| NCT07679516 | Postprandial Regulation of Bone Perfusion in Healthy Individuals | Not applicable | not yet recruiting | 2026-07-09 |
| NCT06422325 | Two Way Crossover Closed Loop Study Insulin vs Insulin and Pramlintide | Not applicable | completed | 2026-06-09 |
| NCT03560960 | Multi-Center Development of a Novel Diagnostic Test for Alzheimer's Disease | Early phase 1 | active not recruiting | 2026-05-28 |
| NCT06619015 | Tailoring Obesity Treatment Trial | Phase 3 | withdrawn | 2026-04-17 |
| NCT07506369 | Pancreatic Polypeptide as a Modulator of Amylin- Induced Satiety in Healthy Humans | Not applicable | recruiting | 2026-04-01 |
| NCT07340788 | Amylin-Induced Migraine Attacks Without Aura | Not applicable | not yet recruiting | 2026-01-14 |
Pramlintide — reconstitution calculator
Enter how much peptide is in the vial and how much diluent (e.g. bacteriostatic water) is added. The tool returns the resulting solution concentration — and, for any amount you type, the volume it corresponds to. This is educational arithmetic, not a dosing recommendation.
Reference form: Pramlintide (source record; form not independently established)Average reference mass: 3,949 Da
Enter an amount to see the volume it corresponds to.
Educational concentration mathematics only. This tool does not recommend a dose, amount, or protocol, and nothing here is medical advice. Many peptides are not authorized by Health Canada for human use — see our reconstitution and bacteriostatic-water guides for context.
FAQ about Pramlintide
What is Pramlintide?+
Pramlintide is a synthetic analog of the pancreatic hormone amylin, designed with proline substitutions so it stays soluble rather than aggregating. It is an approved prescription medicine in the United States used alongside insulin, and is a common case study in peptide formulation and analog design.
What Canadian product status is recorded for Pramlintide?+
Canadian product status for Pramlintide has not been verified in this profile. No verified record here does not mean no authorization exists. Status depends on the product, formulation and use; consult Health Canada's product records.
What is the typical length of Pramlintide?+
Pramlintide is commonly described as approximately 37 amino acids (Amylin analog).
Related peptides
References & further reading
- 1.McQueen (2005). Pramlintide acetate. Am J Health Syst Pharm
- 2.Sheehan et al. (2022). Pramlintide for post-bariatric hypoglycaemia. Diabetes Obes Metab
- 3.Ceriello et al. (2005). Effects of pramlintide on postprandial glucose excursions and measures of oxidative stress in patients with type 1 diabetes. Diabetes Care
- 4.PubChem — compound summary for Pramlintide (CID 70691388)
- 5.Wikipedia — Pramlintide