Engineered amylin analog: proline substitutions prevent the amyloid aggregation seen with native human amylin.
Also known as: Symlin · AC-137
Part of the Metabolic & GLP-1 peptides cluster
Overview
Pramlintide is a synthetic analog of the pancreatic hormone amylin, designed with proline substitutions so it stays soluble rather than aggregating. It is an approved prescription medicine in the United States used alongside insulin, and is a common case study in peptide formulation and analog design.
Source & context
Biological / chemical source: Synthetic peptide (soluble, non-aggregating amylin analog)
Primary research or clinical context: Approved prescription medicine in the United States (adjunct to insulin); prescription only
Why the substitutions matter
Native human amylin readily forms insoluble amyloid fibrils, which makes it unsuitable as a drug. Pramlintide replaces three residues (positions 25, 28 and 29) with proline, disrupting the beta-sheet stacking that drives aggregation while retaining receptor activity. It is a textbook example of sequence editing to solve a formulation problem.
Regulatory and educational context
Pramlintide is a regulated prescription product, not a research chemical. This page is educational and describes its chemistry and approval history only. It is administered under medical supervision, and any decision about prescription medicines belongs with a licensed clinician — not with online protocol discussions.
Sequence
One-letter sequence commonly cited for Pramlintide (educational; isoforms and modifications may differ):
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
FAQ about Pramlintide
What is Pramlintide?+
Pramlintide is a synthetic analog of the pancreatic hormone amylin, designed with proline substitutions so it stays soluble rather than aggregating. It is an approved prescription medicine in the United States used alongside insulin, and is a common case study in peptide formulation and analog design.
Is Pramlintide an approved medicine?+
Pramlintide: Approved prescription medicine in the United States (adjunct to insulin); prescription only. Always follow licensed medical guidance for approved products.
What is the typical length of Pramlintide?+
Pramlintide is commonly described as approximately 37 amino acids (Amylin analog).