One of the most abundant neuropeptides in the mammalian brain.
Also known as: NPY
Part of the Neuropeptides & signaling cluster
Overview
Neuropeptide Y (NPY) is a 36-amino-acid neuropeptide widely distributed in the nervous system. Research examines its roles in appetite, stress responses, and energy balance through a family of Y receptors.
Source & context
Biological / chemical source: Central and peripheral nervous system
Primary research or clinical context: Neuroscience and metabolism research
Receptor family
NPY signals through several G-protein-coupled receptors (Y1, Y2, Y4, Y5). Studying which receptor subtype mediates a given effect is a central theme in NPY neuroscience, because the same peptide can produce different outcomes depending on receptor and brain region.
Why it is studied
As one of the most abundant peptides in the brain, NPY is a reference molecule for feeding, circadian, and stress-related research. This page describes physiology only and does not present NPY as a treatment for any condition.
Sequence
One-letter sequence commonly cited for Neuropeptide Y (educational; isoforms and modifications may differ):
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
FAQ about Neuropeptide Y
What is Neuropeptide Y?+
Neuropeptide Y (NPY) is a 36-amino-acid neuropeptide widely distributed in the nervous system. Research examines its roles in appetite, stress responses, and energy balance through a family of Y receptors.
Is Neuropeptide Y an approved medicine?+
Neuropeptide Y is discussed here as a research / educational topic. Neuroscience and metabolism research. This is not medical advice.
What is the typical length of Neuropeptide Y?+
Neuropeptide Y is commonly described as approximately 36 amino acids (Neuropeptide).