An intestinotrophic gut hormone co-released with GLP-1 that expands the absorptive surface.
Also known as: GLP-2 · teduglutide (analog)
Part of the Metabolic & GLP-1 peptides cluster
Overview
Glucagon-like peptide-2 (GLP-2) is a 33-amino-acid gut hormone produced from proglucagon in intestinal L cells and co-released with GLP-1. Acting through the GLP-2 receptor, it promotes intestinal growth, mucosal integrity and nutrient absorption. This page is educational and not medical advice.
Source & context
Biological / chemical source: Secreted by intestinal L cells (proglucagon gene)
Primary research or clinical context: Intestinal physiology and short-bowel research
Origin and actions
GLP-2 is cleaved from the same proglucagon precursor as GLP-1 and secreted after meals. It increases intestinal villus height and crypt depth, enhances barrier function and blood flow, and reduces bone breakdown, with a short native half-life because of DPP-4 degradation.
Therapeutic analog
The DPP-4-resistant analog teduglutide substitutes glycine for alanine at position 2, extending its half-life, and is approved for short bowel syndrome. This makes GLP-2 a well-characterized model for intestinal-adaptation and gut-hormone research.
Sequence
One-letter sequence commonly cited for Glucagon-like peptide-2 (educational; isoforms and modifications may differ):
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
FAQ about Glucagon-like peptide-2
What is Glucagon-like peptide-2?+
Glucagon-like peptide-2 (GLP-2) is a 33-amino-acid gut hormone produced from proglucagon in intestinal L cells and co-released with GLP-1. Acting through the GLP-2 receptor, it promotes intestinal growth, mucosal integrity and nutrient absorption. This page is educational and not medical advice.
Is Glucagon-like peptide-2 an approved medicine?+
Glucagon-like peptide-2 is discussed here as a research / educational topic. Intestinal physiology and short-bowel research. This is not medical advice.
What is the typical length of Glucagon-like peptide-2?+
Glucagon-like peptide-2 is commonly described as approximately 33 amino acids (Peptide hormone (proglucagon-derived)).