Venom-derived GLP-1 mimetic resistant to DPP-4.
Part of the Metabolic & GLP-1 peptides cluster
Overview
Exendin-4 is a 39-residue peptide from Gila monster venom that activates the GLP-1 receptor and inspired the drug exenatide.
Source & context
Biological / chemical source: Gila monster venom homolog
Primary research or clinical context: Basis for exenatide (approved)
From venom to medicine
Exendin-4’s resistance to DPP-4 cleavage made it a template for incretin mimetic drugs — a famous natural-product-to-pharmacy story in peptide science.
Sequence
One-letter sequence commonly cited for Exendin-4 (educational; isoforms and modifications may differ):
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Analyze sequences in the playground →FAQ about Exendin-4
What is Exendin-4?+
Exendin-4 is a 39-residue peptide from Gila monster venom that activates the GLP-1 receptor and inspired the drug exenatide.
Is Exendin-4 an approved medicine?+
Exendin-4: Basis for exenatide (approved). Always follow licensed medical guidance for approved products.
What is the typical length of Exendin-4?+
Exendin-4 is commonly described as approximately 39 amino acids (Incretin mimetic).