One of the few GLP-1 agonists that is the exact native human sequence rather than a modified analog.
Also known as: recombinant human GLP-1 (7-36) · rhGLP-1
Part of the Metabolic & GLP-1 peptides cluster
Overview
Beinaglutide is a recombinant human GLP-1(7-36) that shares 100% sequence identity with native human GLP-1. Approved in China for type 2 diabetes and studied for weight management, it is a useful contrast to modified analogs like semaglutide. It is not authorized by Health Canada, and this page is educational only.
Source & context
Biological / chemical source: Recombinant human GLP-1(7-36), 100% identical in sequence to native human GLP-1
Primary research or clinical context: Approved in China (NMPA) for type 2 diabetes and studied for weight management; not authorized by Health Canada
Native sequence, short half-life
Because beinaglutide is the unmodified human GLP-1(7-36) sequence, it is rapidly degraded by DPP-4 and has a short half-life, so reported protocols use frequent daily dosing rather than the weekly schedule of modified analogs. It is a clear teaching example of why most GLP-1 drugs are engineered for protease resistance and extended action.
Regulatory context
Beinaglutide is approved by China's National Medical Products Administration for type 2 diabetes and has been studied for weight management in Chinese adults. It is not authorized by Health Canada. This page summarizes its chemistry and development for education only and does not recommend its use or claim any therapeutic benefit.
Sequence
One-letter sequence commonly cited for Beinaglutide (educational; isoforms and modifications may differ):
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.
FAQ about Beinaglutide
What is Beinaglutide?+
Beinaglutide is a recombinant human GLP-1(7-36) that shares 100% sequence identity with native human GLP-1. Approved in China for type 2 diabetes and studied for weight management, it is a useful contrast to modified analogs like semaglutide. It is not authorized by Health Canada, and this page is educational only.
Is Beinaglutide an approved medicine?+
Beinaglutide is discussed here as a research / educational topic. Approved in China (NMPA) for type 2 diabetes and studied for weight management; not authorized by Health Canada. This is not medical advice.
What is the typical length of Beinaglutide?+
Beinaglutide is commonly described as approximately 30 amino acids (GLP-1 receptor agonist (recombinant human GLP-1)).