Skip to content
Peptides Codex
ENFR

Use the arrow keys to choose a result, Enter to open it, and Escape to close.

← Home
GLP-1 receptor agonist (recombinant human GLP-1)

Beinaglutide

Beinaglutide is a recombinant human GLP-1(7-36) that shares 100% sequence identity with native human GLP-1.

By The Peptides Codex Editorial TeamIndividual review date not recorded

Page data last changed: . Chemistry registry snapshot: . Registry refreshes and identity assessments are separate from scientific content review.

Length
30 aa
Class
GLP-1 receptor agonist (recombinant human GLP-1)
Function
Full-length recombinant human GLP-1(7-36) that engages the GLP-1 receptor in glucose and satiety signalling
Context
Approved in China (NMPA) for type 2 diabetes and studied for weight management; not authorized by Health Canada

One of the few GLP-1 agonists that is the exact native human sequence rather than a modified analog.

Also known as: recombinant human GLP-1 (7-36) · rhGLP-1

Part of the Metabolic & GLP-1 peptides cluster

Overview

Beinaglutide is a recombinant human GLP-1(7-36) that shares 100% sequence identity with native human GLP-1. Approved in China for type 2 diabetes and studied for weight management, it is a useful contrast to modified analogs like semaglutide. It is not authorized by Health Canada, and this page is educational only.

Source & context

Biological / chemical source: Recombinant human GLP-1(7-36), 100% identical in sequence to native human GLP-1

Primary research or clinical context: Approved in China (NMPA) for type 2 diabetes and studied for weight management; not authorized by Health Canada

Native sequence, short half-life

Because beinaglutide is the unmodified human GLP-1(7-36) sequence, it is rapidly degraded by DPP-4 and has a short half-life, so reported protocols use frequent daily dosing rather than the weekly schedule of modified analogs. It is a clear teaching example of why most GLP-1 drugs are engineered for protease resistance and extended action.

Regulatory context

Beinaglutide is approved by China's National Medical Products Administration for type 2 diabetes and has been studied for weight management in Chinese adults. It is not authorized by Health Canada. This page summarizes its chemistry and development for education only and does not recommend its use or claim any therapeutic benefit.

Sequence

One-letter sequence commonly cited for Beinaglutide (educational; isoforms and modifications may differ):

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Beinaglutide30 aa · C149H225N39O46 · ≈ 3,298.6 DaPEPTIDESCODEX.COMN-terminus →→ C-terminusH1A2E−3G4T5F6T7S8D−9V10S11S12Y13L14E−15G16Q17A18A19K+20E−21F22I23A24W25L26V27K+28G29R+30nonpolarpolaracidicbasicGly / Pronon-canonical (X)Hydropathy (Kyte–Doolittle): ▮ hydrophobic (cyan) / ▮ hydrophilic (rose) · Side-chain charge at pH 7: + / −
Beinaglutide — Structure cardDownload SVG
H1A2E3G4T5F6T7S8D9V10S11S12Y13L14E15G16Q17A18A19K20E21F22I23A24W25L26V27K28G29R30
Helical wheel projection

Residues plotted ~100° apart around an α-helix — clustering of one color reveals an amphipathic face.

Analyze sequences in the playground →

Structure & chemistry

Molecular identity & reference confidence

Source-supported reference

Reference values are taken from the cited molecular record or curated profile. A database match is not independent laboratory verification; modifications, counter-ions, and formulations can change the measured mass.

Molecular form
Beinaglutide (source record; form not independently established)
Species
Not established by this molecular identity audit
Termini (N / C)
Not specified / Not specified

Average reference mass

Reference policy updated: 2026-10-05

Molecular formula
C149H225N39O46
Average reference mass
≈ 3,298.6
Status
Approved medicine in at least one jurisdiction (IUPHAR record)
Identifiers

Chemistry values: PubChem, IUPHAR/BPS Guide to Pharmacology · fetched 2026-10-01.

Clinical development snapshot

ClinicalTrials.gov lists 3 registered studies with “Beinaglutide” as an intervention (snapshot 2026-09-06). A registry footprint is not evidence of efficacy or approval.

Registered studies
3
Highest phase reached
Phase 4
Active in latest 100
1
Most recent update
2025-05-02
Most recently updated studies
NCTTitlePhaseStatusUpdated
NCT03987308Comparing the Efficacy and Safety Between Continuous Subcutaneous Beinaglutide and CSII for Newly Diagnosed T2Not applicablerecruiting2025-05-02
NCT05005741The Effects of Glucose Control and Weight Loss Between Beinaglutide and Dulaglutide in Type 2 Diabetes With OvPhase 4unknown2023-03-17
NCT03829891Study for Beinaglutide Versus Glargine Therapy in Glycemic Variability of Type 2 Diabetes MellitusNot applicablecompleted2022-01-19
See all on ClinicalTrials.gov →
Concentration math

Beinaglutide — reconstitution calculator

Enter how much peptide is in the vial and how much diluent (e.g. bacteriostatic water) is added. The tool returns the resulting solution concentration — and, for any amount you type, the volume it corresponds to. This is educational arithmetic, not a dosing recommendation.

Reference form: Beinaglutide (source record; form not independently established)Average reference mass: 3,298.6 Da

Syringe graduation
Solution concentration
5 mg/mL5,000 mcg/mL
mcg

Enter an amount to see the volume it corresponds to.

Educational concentration mathematics only. This tool does not recommend a dose, amount, or protocol, and nothing here is medical advice. Many peptides are not authorized by Health Canada for human use — see our reconstitution and bacteriostatic-water guides for context.

Open the Beinaglutide calculator on its own page →

FAQ about Beinaglutide

What is Beinaglutide?+

Beinaglutide is a recombinant human GLP-1(7-36) that shares 100% sequence identity with native human GLP-1. Approved in China for type 2 diabetes and studied for weight management, it is a useful contrast to modified analogs like semaglutide. It is not authorized by Health Canada, and this page is educational only.

What Canadian product status is recorded for Beinaglutide?+

Canadian product status for Beinaglutide has not been verified in this profile. No verified record here does not mean no authorization exists. Status depends on the product, formulation and use; consult Health Canada's product records.

What is the typical length of Beinaglutide?+

Beinaglutide is commonly described as approximately 30 amino acids (GLP-1 receptor agonist (recombinant human GLP-1)).

Related peptides

Beta-endorphin
Neuropeptide
Beta-endorphin is a 31-amino-acid endogenous opioid peptide cleaved from the proopiomelanocortin (POMC) precursor. It is a foundational molecule in pain, stress, and reward neuroscience research.
Ziconotide
Conotoxin analgesic
Ziconotide is the synthetic form of an ω-conotoxin, a 25-amino-acid peptide from cone snail venom that selectively blocks N-type voltage-gated calcium channels. Delivered directly into cerebrospinal fluid by an intrathecal pump, it is an approved therapeutic for severe, refractory chronic pain. Content here is educational only.
Terlipressin
Vasopressin analog
Terlipressin is a synthetic analog of vasopressin built by adding three glycine residues to lysine-vasopressin. It acts as a slow-release prodrug, giving prolonged V1-mediated splanchnic vasoconstriction, and gained FDA approval in 2022 for hepatorenal syndrome. Content here is educational only.
Carbetocin
Oxytocin analog
Carbetocin is a synthetic long-acting analog of oxytocin. Structural modifications extend its half-life to roughly 85-100 minutes versus a few minutes for oxytocin, allowing a single dose to sustain uterine contraction, and it is an approved therapeutic for preventing postpartum hemorrhage. This page is educational and not medical advice.

References & further reading

  1. 1.Chen et al. (2024). Beinaglutide for weight management in Chinese individuals with overweight or obesity: A phase 3 randomized controlled clinical study. Diabetes Obes Metab
  2. 2.Zhang et al. (2021). Recombinant human GLP-1 beinaglutide regulates lipid metabolism of adipose tissues in diet-induced obese mice. iScience
  3. 3.Lin et al. (2024). Pharmacokinetics and safety profiles of beinaglutide injection, a recombinant human GLP-1, in adults with overweight/obesity: results from a phase I clinical trial. Front Pharmacol
  4. 4.Wang et al. (2021). Effect of beinaglutide treatment on weight loss in Chinese patients with type 2 diabetes mellitus and overweight/obesity. Arch Endocrinol Metab
  5. 5.Wen et al. (2023). Short-term effect of beinaglutide combined with metformin versus metformin alone on weight loss and metabolic profiles in obese patients with polycystic ovary syndrome: a pilot randomized trial. Front Endocrinol (Lausanne)
  6. 6.Gao et al. (2022). Comparison of Beinaglutide Versus Metformin for Weight Loss in Overweight and Obese Non-diabetic Patients. Exp Clin Endocrinol Diabetes
  7. 7.Liu et al. (2023). The efficacy and safety of beinaglutide alone or in combination with insulin glargine in Chinese patients with type 2 diabetes mellitus who are inadequately controlled with oral antihyperglycemic therapy: A multicenter, open-label, randomized trial. J Diabetes
  8. 8.Fang et al. (2021). Beinaglutide shows significantly beneficial effects in diabetes/obesity-induced nonalcoholic steatohepatitis in ob/ob mouse model. Life Sci
  9. 9.Frontiers in Pharmacology — Pharmacokinetics and safety of beinaglutide injection, a recombinant human GLP-1
Disclaimer: Educational content only. Not medical advice. Not instructions for human use. Research peptides and unapproved products may be restricted or illegal to market for human consumption in your jurisdiction. Consult qualified professionals and applicable law.
You might also like: All peptides · Atlas · Research · Tools
Cite this: Peptides Codex — Beinaglutide educational profile.
Tip: Use browser print (Ctrl/Cmd + P) for a clean PDF of this page.