Peptides Codex
Home
Incretin analog

Semaglutide

Semaglutide is a modified GLP-1 receptor agonist peptide designed for extended half-life. It is an approved prescription medicine in many jurisdictions and a major case study in peptide engineering.

By The Peptides Codex Editorial TeamReviewed July 10, 2026
Length
31 aa
Class
Incretin analog
Function
Long-acting GLP-1 receptor agonist
Context
Approved for type 2 diabetes & weight management (prescription)

Engineered for half-life: fatty-acid side chain + residue substitutions.

Part of the Metabolic & GLP-1 peptides cluster

Overview

Semaglutide is a modified GLP-1 receptor agonist peptide designed for extended half-life. It is an approved prescription medicine in many jurisdictions and a major case study in peptide engineering.

Source & context

Biological / chemical source: Synthetic (modified)

Primary research or clinical context: Approved for type 2 diabetes & weight management (prescription)

Engineering highlights

Key design choices include substitution for DPP-4 resistance and a C18 fatty diacid side chain that enables albumin binding and once-weekly dosing in approved products.

Educational note

Discussions of semaglutide on this site are educational. Use of prescription medicines should follow licensed medical guidance only.

Sequence

One-letter sequence commonly cited for Semaglutide (educational; isoforms and modifications may differ):

HGEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

HGEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

Analyze sequences in the playground →

FAQ about Semaglutide

What is Semaglutide?+

Semaglutide is a modified GLP-1 receptor agonist peptide designed for extended half-life. It is an approved prescription medicine in many jurisdictions and a major case study in peptide engineering.

Is Semaglutide an approved medicine?+

Semaglutide: Approved for type 2 diabetes & weight management (prescription). Always follow licensed medical guidance for approved products.

What is the typical length of Semaglutide?+

Semaglutide is commonly described as approximately 31 amino acids (Incretin analog).

Related peptides

References & further reading

  1. 1.Wikipedia — Semaglutide
  2. 2.PubChem — compound summary for Semaglutide (CID 56843331)
Disclaimer: Educational content only. Not medical advice. Not instructions for human use. Research peptides and unapproved products may be restricted or illegal to market for human consumption in your jurisdiction. Consult qualified professionals and applicable law.
You might also like: All peptides · Atlas · Research · Tools
Cite this: Peptides Codex — Semaglutide educational profile.
Tip: Use browser print (Ctrl/Cmd + P) for a clean PDF of this page.